PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.K00328.1.p
Common NameLOC105961432, MIMGU_mgv1a004242mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 539aa    MW: 59009.6 Da    PI: 6.4148
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.K00328.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY80.32e-25183239259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +DgynWrKYGqK+vk+ e +rsYYrCt+++C++kk +e+s++ ++++e++Y+++Hnh+
  Migut.K00328.1.p 183 SDGYNWRKYGQKQVKSPEGSRSYYRCTFSDCCAKK-IECSDRSNRLIETVYRSHHNHD 239
                       7********************************98.*********************7 PP

2WRKY96.61.7e-30383439359
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e + ++ ++v+itY+g H+he
  Migut.K00328.1.p 383 DGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIESAVDNANAVVITYKGMHDHE 439
                       9*******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-21175241IPR003657WRKY domain
SuperFamilySSF1182905.75E-20179241IPR003657WRKY domain
SMARTSM007742.5E-24182240IPR003657WRKY domain
PROSITE profilePS5081118.969183241IPR003657WRKY domain
PfamPF031061.4E-17184239IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.9E-31366441IPR003657WRKY domain
SuperFamilySSF1182909.42E-27374441IPR003657WRKY domain
PROSITE profilePS5081131.479376441IPR003657WRKY domain
SMARTSM007742.9E-34381440IPR003657WRKY domain
PfamPF031062.8E-23383438IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MEEERNRSSV ALPVTEIENS TPLNGGEGEI RDQIIIIEKI DEQRPVLNYA AGNNSGGESK  60
APEFETLDSV QLPEGDLQAD FDESSHLLSE VPVEYSLQPL KPTEEIEDQV TAMHDESLKC  120
ITGRSAELVV QHQMQAEAPN SIVPTSKLQP ENGNNLCLTE NNMQNSPDPK PLAAAMPTQK  180
NPSDGYNWRK YGQKQVKSPE GSRSYYRCTF SDCCAKKIEC SDRSNRLIET VYRSHHNHDP  240
PQKMNCTREN RPSLAIVPST PSKESLPSTP LKESLPSTPL KESLPSIPLK ESLPPTPSKE  300
SLPPIPSKEA LSGAHDVPEI KQQESSDSDQ TTETNAKEEY ADGSESRKRQ KSNSADVLES  360
LPKPGKKSKY VVHAAVDVGI SGDGYRWRKY GQKMVKGNPH PRNYYRCTSA GCPVRKHIES  420
AVDNANAVVI TYKGMHDHET PVPRKRHSPK SATTHSPRSA THWPKSATAN AASANAASSP  480
PVPLDDLQNK TNPHTTSRTQ WSVSKEGELT GEAMNVAGEK ESGSARTLLS VGFEIKPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-24368441174WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012841117.10.0PREDICTED: probable WRKY transcription factor 32
TrEMBLA0A022R3070.0A0A022R307_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA91892127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.17e-94WRKY DNA-binding protein 32